Lineage for d2a0fc2 (2a0f C:151-310)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2513848Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 2513849Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. 2513850Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins)
  6. 2513851Protein Aspartate carbamoyltransferase catalytic subunit [53673] (7 species)
  7. 2513859Species Escherichia coli [TaxId:562] [53674] (63 PDB entries)
    Uniprot P00479
  8. 2514127Domain d2a0fc2: 2a0f C:151-310 [125951]
    Other proteins in same PDB: d2a0fb1, d2a0fb2, d2a0fd1, d2a0fd2
    automatically matched to d1ekxa2
    complexed with pct, zn; mutant

Details for d2a0fc2

PDB Entry: 2a0f (more details), 2.9 Å

PDB Description: structure of d236a mutant e. coli aspartate transcarbamoylase in presence of phosphonoacetamide at 2.90 a resolution
PDB Compounds: (C:) Aspartate carbamoyltransferase catalytic chain

SCOPe Domain Sequences for d2a0fc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a0fc2 c.78.1.1 (C:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]}
rldnlhvamvgdlkygrtvhsltqalakfdgnrfyfiapdalampqyildmldekgiaws
lhssieevmaevdilymtrvqkerlapseyanvkaqfvlrasdlhnakanmkvlhplprv
deiatdvdktphawyfqqagngifarqallalvlnrdlvl

SCOPe Domain Coordinates for d2a0fc2:

Click to download the PDB-style file with coordinates for d2a0fc2.
(The format of our PDB-style files is described here.)

Timeline for d2a0fc2: