SCOPe 2.06: Domain d2a0fc2: 2a0f C:151-310

Lineage for d2a0fc2 (2a0f C:151-310)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families)

5. Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins)

6. Protein Aspartate carbamoyltransferase catalytic subunit [53673] (7 species)

7. Species Escherichia coli [TaxId:562] [53674] (63 PDB entries)
   Uniprot P00479

8. Domain d2a0fc2: 2a0f C:151-310 [125951]
   Other proteins in same PDB: d2a0fb1, d2a0fb2, d2a0fd1, d2a0fd2
   automatically matched to d1ekxa2
   complexed with pct, zn; mutant

Details for d2a0fc2

PDB Entry: 2a0f, 2.9 Å

PDB Description: structure of d236a mutant e. coli aspartate transcarbamoylase in presence of phosphonoacetamide at 2.90 a resolution

PDB Compounds: (C:) Aspartate carbamoyltransferase catalytic chain

SCOPe Domain Sequences for d2a0fc2:

Sequence; same for both SEQRES and ATOM records:

>d2a0fc2 c.78.1.1 (C:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]}
rldnlhvamvgdlkygrtvhsltqalakfdgnrfyfiapdalampqyildmldekgiaws
lhssieevmaevdilymtrvqkerlapseyanvkaqfvlrasdlhnakanmkvlhplprv
deiatdvdktphawyfqqagngifarqallalvlnrdlvl

Timeline for d2a0fc2:

• d2a0fc2 first appeared in SCOP 1.73
  
• d2a0fc2 appears in SCOPe 2.05
  
• d2a0fc2 appears in SCOPe 2.07
  
• d2a0fc2 appears in the current release, SCOPe 2.08