Lineage for d2a0aa1 (2a0a A:1-131)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2804862Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 2805066Protein Der f 13 allergen [141467] (1 species)
  7. 2805067Species House dust mite (Dermatophagoides farinae) [TaxId:6954] [141468] (1 PDB entry)
    Uniprot Q1M2P5 1-131
  8. 2805068Domain d2a0aa1: 2a0a A:1-131 [125944]

Details for d2a0aa1

PDB Entry: 2a0a (more details)

PDB Description: solution structure of der f 13, group 13 allergen from house dust mites
PDB Compounds: (A:) Der f 13

SCOPe Domain Sequences for d2a0aa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a0aa1 b.60.1.2 (A:1-131) Der f 13 allergen {House dust mite (Dermatophagoides farinae) [TaxId: 6954]}
masiegkykleksekfdefldklgvgfmvktaaktlkptfevaiendqyifrslstfknt
eakfklgeefeedradgkrvktviqkegdnkfvqtqfgdkevkiirefngdevvvtascd
gvtsvrtykri

SCOPe Domain Coordinates for d2a0aa1:

Click to download the PDB-style file with coordinates for d2a0aa1.
(The format of our PDB-style files is described here.)

Timeline for d2a0aa1: