Lineage for d2a07g_ (2a07 G:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. Protein automated matches [190154] (91 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [186924] (29 PDB entries)
  8. Domain d2a07g_: 2a07 G: [125939]
    Other proteins in same PDB: d2a07f1
    automated match to d1d5va_
    protein/DNA complex; complexed with mg

Details for d2a07g_

PDB Entry: 2a07 (more details), 1.9 Å

PDB Description: Crystal Structure of Foxp2 bound Specifically to DNA.
PDB Compounds: (G:) Forkhead box protein P2

SCOPe Domain Sequences for d2a07g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a07g_ a.4.5.0 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pftyatlirqaimessdrqltlneiyswftrtfayfrrnaatwknavrhnlslhkcfvrv
envkgavwtvdeveyqkrr

SCOPe Domain Coordinates for d2a07g_ are not available.

Timeline for d2a07g_:

Domains from other chains:
(mouse over for more information)
d2a07f1, d2a07h_, d2a07i_, d2a07j_, d2a07k_