Lineage for d2a07f1 (2a07 F:503-584)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693299Family a.4.5.14: Forkhead DNA-binding domain [46832] (7 proteins)
  6. 2693307Protein Forkhead box protein P2, FOXP2 [140265] (1 species)
  7. 2693308Species Human (Homo sapiens) [TaxId:9606] [140266] (1 PDB entry)
    Uniprot O15409 503-584
  8. 2693309Domain d2a07f1: 2a07 F:503-584 [125938]
    Other proteins in same PDB: d2a07g_, d2a07h_, d2a07i_, d2a07j_, d2a07k_
    protein/DNA complex; complexed with mg

Details for d2a07f1

PDB Entry: 2a07 (more details), 1.9 Å

PDB Description: crystal structure of foxp2 bound specifically to dna.
PDB Compounds: (F:) Forkhead box protein P2

SCOPe Domain Sequences for d2a07f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a07f1 a.4.5.14 (F:503-584) Forkhead box protein P2, FOXP2 {Human (Homo sapiens) [TaxId: 9606]}
vrppftyatlirqaimessdrqltlneiyswftrtfayfrrnaatwknavrhnlslhkcf
vrvenvkgavwtvdeveyqkrr

SCOPe Domain Coordinates for d2a07f1:

Click to download the PDB-style file with coordinates for d2a07f1.
(The format of our PDB-style files is described here.)

Timeline for d2a07f1: