Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.14: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81514] (1 family) automatically mapped to Pfam PF05365 |
Family f.23.14.1: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81513] (2 proteins) |
Protein Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81512] (3 species) interacts with cytochrome c1 and ISP |
Species Cow (Bos taurus) [TaxId:9913] [81509] (20 PDB entries) Uniprot P00130 |
Domain d2a06w_: 2a06 W: [125937] Other proteins in same PDB: d2a06a1, d2a06a2, d2a06b1, d2a06b2, d2a06c1, d2a06c2, d2a06d1, d2a06d2, d2a06e1, d2a06e2, d2a06f_, d2a06g_, d2a06h_, d2a06i_, d2a06n1, d2a06n2, d2a06o1, d2a06o2, d2a06p1, d2a06p2, d2a06q1, d2a06q2, d2a06r1, d2a06r2, d2a06s_, d2a06t_, d2a06u_, d2a06v_ automated match to d1be3j_ complexed with azi, cdl, fes, gol, hec, hem, jzr, pee, po4, sma, unl, uq |
PDB Entry: 2a06 (more details), 2.1 Å
SCOPe Domain Sequences for d2a06w_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a06w_ f.23.14.1 (W:) Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]} vaptltarlysllfrrtstfaltivvgalfferafdqgadaiyehinegklwkhikhkye nk
Timeline for d2a06w_:
View in 3D Domains from other chains: (mouse over for more information) d2a06a1, d2a06a2, d2a06b1, d2a06b2, d2a06c1, d2a06c2, d2a06d1, d2a06d2, d2a06e1, d2a06e2, d2a06f_, d2a06g_, d2a06h_, d2a06i_, d2a06j_, d2a06n1, d2a06n2, d2a06o1, d2a06o2, d2a06p1, d2a06p2, d2a06q1, d2a06q2, d2a06r1, d2a06r2, d2a06s_, d2a06t_, d2a06u_, d2a06v_ |