Lineage for d2a06u_ (2a06 U:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2255712Fold f.28: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81532] (1 superfamily)
    membrane-associated alpha-helical protein; no transmembrane helices
  4. 2255713Superfamily f.28.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81531] (1 family) (S)
    location - intermembrane side of the bc1 complex
    automatically mapped to Pfam PF02320
  5. 2255714Family f.28.1.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81530] (2 proteins)
    "acidic/hinge protein", essential for the complex formation, interacts with the functional domain of cytochrome c1
  6. 2255745Protein automated matches [190042] (3 species)
    not a true protein
  7. 2255763Species Cow (Bos taurus) [TaxId:9913] [186764] (6 PDB entries)
  8. 2255765Domain d2a06u_: 2a06 U: [125936]
    Other proteins in same PDB: d2a06a1, d2a06a2, d2a06b1, d2a06b2, d2a06c1, d2a06c2, d2a06d1, d2a06d2, d2a06e1, d2a06e2, d2a06f_, d2a06g_, d2a06i_, d2a06j_, d2a06n1, d2a06n2, d2a06o1, d2a06o2, d2a06p1, d2a06p2, d2a06q1, d2a06q2, d2a06r1, d2a06r2, d2a06s_, d2a06t_, d2a06v_, d2a06w_
    automated match to d1l0lh_
    complexed with azi, bhg, cdl, fes, gol, hec, hem, pee, po4, sma, unl, uq

Details for d2a06u_

PDB Entry: 2a06 (more details), 2.1 Å

PDB Description: bovine cytochrome bc1 complex with stigmatellin bound
PDB Compounds: (U:) Ubiquinol-cytochrome c reductase complex 11 kDa protein

SCOPe Domain Sequences for d2a06u_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a06u_ f.28.1.1 (U:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
lvdplttvreqceqlekcvkarerlelcdervssrsqteedcteelldflhardhcvahk
lfnslk

SCOPe Domain Coordinates for d2a06u_:

Click to download the PDB-style file with coordinates for d2a06u_.
(The format of our PDB-style files is described here.)

Timeline for d2a06u_: