SCOPe 2.06: Domain d2a06s_: 2a06 S:

Lineage for d2a06s_ (2a06 S:)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.27: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81525] (1 superfamily)
   membrane-associated alpha-helical protein; no transmembrane helices

4. Superfamily f.27.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81524] (1 family)
   location - matrix side of the bc1 complex
   automatically mapped to Pfam PF02271

5. Family f.27.1.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81523] (2 proteins)
   probably important for the complex assembly, caps the matrix face of cytochrome b

6. Protein automated matches [190325] (4 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [192447] (4 PDB entries)

8. Domain d2a06s_: 2a06 S: [125934]
   Other proteins in same PDB: d2a06a1, d2a06a2, d2a06b1, d2a06b2, d2a06c1, d2a06c2, d2a06d1, d2a06d2, d2a06e1, d2a06e2, d2a06g_, d2a06h_, d2a06i_, d2a06j_, d2a06n1, d2a06n2, d2a06o1, d2a06o2, d2a06p1, d2a06p2, d2a06q1, d2a06q2, d2a06r1, d2a06r2, d2a06t_, d2a06u_, d2a06v_, d2a06w_
   automated match to d1qcrf_
   complexed with azi, bhg, cdl, fes, gol, hec, hem, pee, po4, sma, unl, uq

Details for d2a06s_

PDB Entry: 2a06, 2.1 Å

PDB Description: bovine cytochrome bc1 complex with stigmatellin bound

PDB Compounds: (S:) Ubiquinol-cytochrome c reductase complex 14 kDa protein

SCOPe Domain Sequences for d2a06s_:

Sequence; same for both SEQRES and ATOM records:

>d2a06s_ f.27.1.1 (S:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
wlegirkwyynaagfnklglmrddtihenddvkeairrlpenlyddrvfrikraldlsmr
qqilpkeqwtkyeedksylepylkevirerkereewakk

Timeline for d2a06s_:

• d2a06s_ first appeared in SCOP 1.73, called d2a06s1
  
• d2a06s_ appears in SCOPe 2.05
  
• d2a06s_ appears in SCOPe 2.07
  
• d2a06s_ appears in the current release, SCOPe 2.08