![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily) core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta |
![]() | Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) ![]() Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues |
![]() | Family d.185.1.1: MPP-like [63412] (7 proteins) Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal |
![]() | Protein Cytochrome bc1 core subunit 1 [63408] (3 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [55997] (19 PDB entries) Uniprot P31800 |
![]() | Domain d2a06n1: 2a06 N:1-233 [125928] Other proteins in same PDB: d2a06b1, d2a06b2, d2a06c1, d2a06c2, d2a06d1, d2a06d2, d2a06e1, d2a06e2, d2a06f_, d2a06g_, d2a06h_, d2a06i_, d2a06j_, d2a06o1, d2a06o2, d2a06p1, d2a06p2, d2a06q1, d2a06q2, d2a06r1, d2a06r2, d2a06s_, d2a06t_, d2a06u_, d2a06v_, d2a06w_ automated match to d1ntma1 complexed with azi, cdl, fes, gol, hec, hem, jzr, pee, po4, sma, unl, uq |
PDB Entry: 2a06 (more details), 2.1 Å
SCOPe Domain Sequences for d2a06n1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a06n1 d.185.1.1 (N:1-233) Cytochrome bc1 core subunit 1 {Cow (Bos taurus) [TaxId: 9913]} tatyaqalqsvpetqvsqldnglrvaseqssqptctvgvwidagsryeseknngagyfve hlafkgtknrpgnalekevesmgahlnaystrehtayyikalskdlpkavelladivqnc sledsqiekerdvilqelqendtsmrdvvfnylhatafqgtplaqsvegpsenvrklsra dlteylsrhykaprmvlaaagglehrqlldlaqkhfsglsgtydedavptlsp
Timeline for d2a06n1:
![]() Domains from other chains: (mouse over for more information) d2a06a1, d2a06a2, d2a06b1, d2a06b2, d2a06c1, d2a06c2, d2a06d1, d2a06d2, d2a06e1, d2a06e2, d2a06f_, d2a06g_, d2a06h_, d2a06i_, d2a06j_, d2a06o1, d2a06o2, d2a06p1, d2a06p2, d2a06q1, d2a06q2, d2a06r1, d2a06r2, d2a06s_, d2a06t_, d2a06u_, d2a06v_, d2a06w_ |