SCOPe 2.07: Domain d2a06g_: 2a06 G:

Lineage for d2a06g_ (2a06 G:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.13: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81508] (1 family)
   automatically mapped to Pfam PF02939

5. Family f.23.13.1: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81507] (2 proteins)

6. Protein Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81506] (3 species)
   together with cytochrome b binds to ubiquinone

7. Species Cow (Bos taurus) [TaxId:9913] [81503] (21 PDB entries)
   Uniprot P13271 #SP ! Uniprot P13271

8. Domain d2a06g_: 2a06 G: [125926]
   Other proteins in same PDB: d2a06a1, d2a06a2, d2a06b1, d2a06b2, d2a06c1, d2a06c2, d2a06d1, d2a06d2, d2a06e1, d2a06e2, d2a06f_, d2a06h_, d2a06i_, d2a06j_, d2a06n1, d2a06n2, d2a06o1, d2a06o2, d2a06p1, d2a06p2, d2a06q1, d2a06q2, d2a06r1, d2a06r2, d2a06s_, d2a06u_, d2a06v_, d2a06w_
   automated match to d1be3g_
   complexed with azi, cdl, fes, gol, hec, hem, jzr, pee, po4, sma, unl, uq

Details for d2a06g_

PDB Entry: 2a06, 2.1 Å

PDB Description: bovine cytochrome bc1 complex with stigmatellin bound

PDB Compounds: (G:) ubiquinol-cytochrome c reductase complex ubiquinone-binding protein qp-c

SCOPe Domain Sequences for d2a06g_:

Sequence; same for both SEQRES and ATOM records:

>d2a06g_ f.23.13.1 (G:) Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
grqfghltrvrhvityslspfeqrafphyfskgipnvlrrtracilrvappfvafylvyt
wgtqefekskrknpa

Timeline for d2a06g_:

• d2a06g_ first appeared in SCOP 1.73, called d2a06g1
  
• d2a06g_ appears in SCOPe 2.06
  
• d2a06g_ appears in the current release, SCOPe 2.08