SCOPe 2.08: Domain d2a06d1: 2a06 D:1-195

Lineage for d2a06d1 (2a06 D:1-195)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.3: Cytochrome bc1 domain [46676] (2 proteins)

6. Protein Cytochrome bc1 domain [46677] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [46678] (19 PDB entries)
   Uniprot P00125

8. Domain d2a06d1: 2a06 D:1-195 [125923]
   Other proteins in same PDB: d2a06a1, d2a06a2, d2a06b1, d2a06b2, d2a06c1, d2a06c2, d2a06d2, d2a06e1, d2a06e2, d2a06f_, d2a06g_, d2a06h_, d2a06i_, d2a06j_, d2a06n1, d2a06n2, d2a06o1, d2a06o2, d2a06p1, d2a06p2, d2a06q2, d2a06r1, d2a06r2, d2a06s_, d2a06t_, d2a06u_, d2a06v_, d2a06w_
   automated match to d1ppjd1
   complexed with azi, cdl, fes, gol, hec, hem, jzr, pee, po4, sma, unl, uq

Details for d2a06d1

PDB Entry: 2a06, 2.1 Å

PDB Description: bovine cytochrome bc1 complex with stigmatellin bound

PDB Compounds: (D:) Cytochrome c1, heme protein, mitochondrial

SCOPe Domain Sequences for d2a06d1:

Sequence; same for both SEQRES and ATOM records:

>d2a06d1 a.3.1.3 (D:1-195) Cytochrome bc1 domain {Cow (Bos taurus) [TaxId: 9913]}
sdlelhppsypwshrgllssldhtsirrgfqvykqvcsschsmdyvayrhlvgvcytede
akalaeevevqdgpnedgemfmrpgklsdyfpkpypnpeaaraanngalppdlsyivrar
hggedyvfslltgycepptgvslreglyfnpyfpgqaigmappiynevlefddgtpatms
qvakdvctflrwaae

Timeline for d2a06d1:

• d2a06d1 first appeared in SCOP 1.73
  
• d2a06d1 appears in SCOPe 2.07