SCOP 1.75: Domain d2a06b2: 2a06 B:236-439

Lineage for d2a06b2 (2a06 B:236-439)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
   core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta

4. Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families)
   Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues

5. Family d.185.1.1: MPP-like [63412] (6 proteins)
   Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal

6. Protein Cytochrome bc1 core subunit 2 [63409] (3 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [56001] (9 PDB entries)

8. Domain d2a06b2: 2a06 B:236-439 [125922]
   Other proteins in same PDB: d2a06a1, d2a06a2, d2a06d1, d2a06d2, d2a06f1, d2a06g1, d2a06h1, d2a06n1, d2a06n2, d2a06q1, d2a06q2, d2a06s1, d2a06t1, d2a06u1, d2a06w1
   automatically matched to d1bccb2
   complexed with azi, bhg, cdl, fes, gol, hec, hem, pee, po4, sma, unl, uq

Details for d2a06b2

PDB Entry: 2a06, 2.1 Å

PDB Description: bovine cytochrome bc1 complex with stigmatellin bound

PDB Compounds: (B:) Ubiquinol-cytochrome-c reductase complex core protein 2, mitochondrial

SCOP Domain Sequences for d2a06b2:

Sequence; same for both SEQRES and ATOM records:

>d2a06b2 d.185.1.1 (B:236-439) Cytochrome bc1 core subunit 2 {Chicken (Gallus gallus) [TaxId: 9031]}
kakyhggeireqngdslvhaalvaesaaigsaeanafsvlqhvlgagphvkrgsnatssl
yqavakgvhqpfdvsafnasysdsglfgfytisqaasagdvikaaynqvktiaqgnlsnp
dvqaaknklkagylmsvessegfldevgsqalaagsytppstvlqqidavadadvinaak
kfvsgrksmaasgnlghtpfidel

Timeline for d2a06b2:

• d2a06b2 first appeared in SCOP 1.73
  
• d2a06b2 appears in SCOPe 2.01
  
• d2a06b2 appears in the current release, SCOPe 2.08