![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.220: Metal cation-transporting ATPase, ATP-binding domain N [81661] (1 superfamily) unusual fold; core: beta-alpha(2)-beta(3)-alpha(2)-beta(2); 6-stranded antiparallel beta-sheet, order: 165432 |
![]() | Superfamily d.220.1: Metal cation-transporting ATPase, ATP-binding domain N [81660] (1 family) ![]() |
![]() | Family d.220.1.1: Metal cation-transporting ATPase, ATP-binding domain N [81659] (4 proteins) |
![]() | Protein Potassium-transporting ATPase B chain, KdpB [111270] (1 species) minimal fold of this domain: |
![]() | Species Escherichia coli [TaxId:562] [111271] (5 PDB entries) Uniprot P03960 316-451 |
![]() | Domain d2a00a_: 2a00 A: [125918] automated match to d2a29a1 complexed with anp |
PDB Entry: 2a00 (more details)
SCOPe Domain Sequences for d2a00a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a00a_ d.220.1.1 (A:) Potassium-transporting ATPase B chain, KdpB {Escherichia coli [TaxId: 562]} nrqasefipaqgvdektladaaqlasladetpegrsivilakqrfnlrerdvqslhatfv pftaqsrmsginidnrmirkgsvdairrhveangghfptdvdqkvdqvarqgatplvvve gsrvlgvialkdivkg
Timeline for d2a00a_: