Lineage for d1zzqb1 (1zzq B:299-716)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 738598Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
    unusual fold
  4. 738599Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
  5. 738600Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (1 protein)
  6. 738601Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species)
  7. 738757Species Rat (Rattus norvegicus) [TaxId:10116] [82821] (31 PDB entries)
  8. 738766Domain d1zzqb1: 1zzq B:299-716 [125915]
    automatically matched to d1p6kb_
    complexed with act, dp9, h4b, hem, mtl, zn; mutant

Details for d1zzqb1

PDB Entry: 1zzq (more details), 1.9 Å

PDB Description: rat nnos d597n mutant with l-n(omega)-nitroarginine-(4r)-amino-l- proline amide bound
PDB Compounds: (B:) Nitric-oxide synthase, brain

SCOP Domain Sequences for d1zzqb1:

Sequence, based on SEQRES records: (download)

>d1zzqb1 d.174.1.1 (B:299-716) Nitric oxide (NO) synthase oxygenase domain {Rat (Rattus norvegicus) [TaxId: 10116]}
rflkvknwetdvvltdtlhlkstletgctehicmgsimlpsqhtrkpedvrtkdqlfpla
kefldqyyssikrfgskahmdrleevnkeieststyqlkdteliygakhawrnasrcvgr
iqwsklqvfdardcttahgmfnyicnhvkyatnkgnlrsaitifpqrtdgkhdfrvwnsq
liryagykqpdgstlgdpanvqfteiciqqgwkaprgrfdvlplllqangndpelfqipp
elvlevpirhpkfdwfkdlglkwyglpavsnmlleigglefsacpfsgwymgteigvrny
cdnsrynileevakkmdldmrktsslwkdqalveiniavlysfqsdkvtivdhhsatesf
ikhmeneyrcrggcpadwvwivppmsgsitpvfhqemlnyrltpsfeyqpdpwnthvw

Sequence, based on observed residues (ATOM records): (download)

>d1zzqb1 d.174.1.1 (B:299-716) Nitric oxide (NO) synthase oxygenase domain {Rat (Rattus norvegicus) [TaxId: 10116]}
rflkvknwetdvvltdtlhlkstletgctehicmgsimlpvrtkdqlfplakefldqyys
sikrfgskahmdrleevnkeieststyqlkdteliygakhawrnasrcvgriqwsklqvf
dardcttahgmfnyicnhvkyatnkgnlrsaitifpqrtdgkhdfrvwnsqliryagykq
pdgstlgdpanvqfteiciqqgwkaprgrfdvlplllqangndpelfqippelvlevpir
hpkfdwfkdlglkwyglpavsnmlleigglefsacpfsgwymgteigvrnycdnsrynil
eevakkmdldmrktsslwkdqalveiniavlysfqsdkvtivdhhsatesfikhmeneyr
crggcpadwvwivppmsgsitpvfhqemlnyrltpsfeyqpdpwnthvw

SCOP Domain Coordinates for d1zzqb1:

Click to download the PDB-style file with coordinates for d1zzqb1.
(The format of our PDB-style files is described here.)

Timeline for d1zzqb1: