Lineage for d1zzoa1 (1zzo A:45-178)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 698982Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 698983Superfamily c.47.1: Thioredoxin-like [52833] (22 families) (S)
  5. 699806Family c.47.1.10: Glutathione peroxidase-like [52901] (28 proteins)
  6. 699902Protein Lipoprotein DsbF [142375] (1 species)
  7. 699903Species Mycobacterium tuberculosis [TaxId:1773] [142376] (1 PDB entry)
  8. 699904Domain d1zzoa1: 1zzo A:45-178 [125913]

Details for d1zzoa1

PDB Entry: 1zzo (more details), 1.6 Å

PDB Description: structure of mtb dsbf in its oxidized form.
PDB Compounds: (A:) Rv1677

SCOP Domain Sequences for d1zzoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zzoa1 c.47.1.10 (A:45-178) Lipoprotein DsbF {Mycobacterium tuberculosis [TaxId: 1773]}
tvpaqlqfsaktldghdfhgesllgkpavlwfwapwcptcqgeapvvgqvaashpevtfv
gvagldqvpamqefvnkypvktftqladtdgsvwanfgvtqqpayafvdphgnvdvvrgr
msqdeltrrvtalt

SCOP Domain Coordinates for d1zzoa1:

Click to download the PDB-style file with coordinates for d1zzoa1.
(The format of our PDB-style files is described here.)

Timeline for d1zzoa1: