Lineage for d1zzna1 (1zzn A:4-98)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. Protein Splicesomal U1A protein [54932] (2 species)
    duplication: contains two domains of this fold
  7. Species Human (Homo sapiens) [TaxId:9606] [54933] (54 PDB entries)
    Uniprot P09012 1-97 ! Uniprot P09012 4-98 ! Uniprot P09012 1-98
  8. Domain d1zzna1: 1zzn A:4-98 [125912]
    automatically matched to d1auda_
    protein/RNA complex; complexed with k, mg

Details for d1zzna1

PDB Entry: 1zzn (more details), 3.3699999999999997 Å

PDB Description: crystal structure of a group i intron/two exon complex that includes all catalytic metal ion ligands.
PDB Compounds: (A:) u1 small nuclear ribonucleoprotein a RNA binding domain

SCOPe Domain Sequences for d1zzna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zzna1 d.58.7.1 (A:4-98) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]}
petrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevs
satnalrsmqgfpfydkpmriqyaktdsdiiakmk

SCOPe Domain Coordinates for d1zzna1 are not available.

Timeline for d1zzna1: