Lineage for d1zzka_ (1zzk A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1648551Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily)
    beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta
  4. 1648552Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (2 families) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 1648659Family d.51.1.0: automated matches [227159] (1 protein)
    not a true family
  6. 1648660Protein automated matches [226866] (4 species)
    not a true protein
  7. 1648661Species Human (Homo sapiens) [TaxId:9606] [225002] (8 PDB entries)
  8. 1648662Domain d1zzka_: 1zzk A: [125909]
    automated match to d1ec6a_

Details for d1zzka_

PDB Entry: 1zzk (more details), 0.95 Å

PDB Description: Crystal Structure of the third KH domain of hnRNP K at 0.95A resolution
PDB Compounds: (A:) Heterogeneous nuclear ribonucleoprotein K

SCOPe Domain Sequences for d1zzka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zzka_ d.51.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mgpiittqvtipkdlagsiigkggqrikqirhesgasikideplegsedriititgtqdq
iqnaqyllqnsvkqysgkff

SCOPe Domain Coordinates for d1zzka_:

Click to download the PDB-style file with coordinates for d1zzka_.
(The format of our PDB-style files is described here.)

Timeline for d1zzka_: