Lineage for d1zzjc_ (1zzj C:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1648551Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily)
    beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta
  4. 1648552Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (2 families) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 1648659Family d.51.1.0: automated matches [227159] (1 protein)
    not a true family
  6. 1648660Protein automated matches [226866] (4 species)
    not a true protein
  7. 1648661Species Human (Homo sapiens) [TaxId:9606] [225002] (8 PDB entries)
  8. 1648669Domain d1zzjc_: 1zzj C: [125908]
    automated match to d1ec6a_
    protein/DNA complex

Details for d1zzjc_

PDB Entry: 1zzj (more details), 2.3 Å

PDB Description: Structure of the third KH domain of hnRNP K in complex with 15-mer ssDNA
PDB Compounds: (C:) Heterogeneous nuclear ribonucleoprotein K

SCOPe Domain Sequences for d1zzjc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zzjc_ d.51.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gamgpiittqvtipkdlagsiigkggqrikqirhesgasikideplegsedriititgtq
dqiqnaqyllqnsv

SCOPe Domain Coordinates for d1zzjc_:

Click to download the PDB-style file with coordinates for d1zzjc_.
(The format of our PDB-style files is described here.)

Timeline for d1zzjc_: