| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily) beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta |
Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (2 families) ![]() Prokaryotic and eukaryotic domains share a KH-motif but have different topologies |
| Family d.51.1.0: automated matches [227159] (1 protein) not a true family |
| Protein automated matches [226866] (4 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [225002] (8 PDB entries) |
| Domain d1zzia_: 1zzi A: [125904] automated match to d1ec6a_ protein/DNA complex |
PDB Entry: 1zzi (more details), 1.8 Å
SCOPe Domain Sequences for d1zzia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zzia_ d.51.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gamgpiittqvtipkdlagsiigkggqrikqirhesgasikideplegsedriititgtq
dqiqnaqyllqnsvkqysgkff
Timeline for d1zzia_: