SCOPe 2.04: Domain d1zzia_: 1zzi A:

Lineage for d1zzia_ (1zzi A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily)
   beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta

4. Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (2 families)
   Prokaryotic and eukaryotic domains share a KH-motif but have different topologies

5. Family d.51.1.0: automated matches [227159] (1 protein)
   not a true family

6. Protein automated matches [226866] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225002] (8 PDB entries)

8. Domain d1zzia_: 1zzi A: [125904]
   automated match to d1ec6a_
   protein/DNA complex

Details for d1zzia_

PDB Entry: 1zzi, 1.8 Å

PDB Description: Crystal Structure Analysis of the third KH domain of hnRNP K in complex with ssDNA

PDB Compounds: (A:) Heterogeneous nuclear ribonucleoprotein K

SCOPe Domain Sequences for d1zzia_:

Sequence; same for both SEQRES and ATOM records:

>d1zzia_ d.51.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gamgpiittqvtipkdlagsiigkggqrikqirhesgasikideplegsedriititgtq
dqiqnaqyllqnsvkqysgkff

Timeline for d1zzia_:

• d1zzia_ first appeared in SCOP 1.73, called d1zzia1
  
• d1zzia_ appears in SCOPe 2.03
  
• d1zzia_ appears in SCOPe 2.05
  
• d1zzia_ appears in the current release, SCOPe 2.08, called d1zzia2