Lineage for d1zzia_ (1zzi A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1412291Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily)
    beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta
  4. 1412292Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (2 families) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 1412392Family d.51.1.0: automated matches [227159] (1 protein)
    not a true family
  6. 1412393Protein automated matches [226866] (3 species)
    not a true protein
  7. 1412394Species Human (Homo sapiens) [TaxId:9606] [225002] (3 PDB entries)
  8. 1412396Domain d1zzia_: 1zzi A: [125904]
    automated match to d1ec6a_
    protein/DNA complex

Details for d1zzia_

PDB Entry: 1zzi (more details), 1.8 Å

PDB Description: Crystal Structure Analysis of the third KH domain of hnRNP K in complex with ssDNA
PDB Compounds: (A:) Heterogeneous nuclear ribonucleoprotein K

SCOPe Domain Sequences for d1zzia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zzia_ d.51.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gamgpiittqvtipkdlagsiigkggqrikqirhesgasikideplegsedriititgtq
dqiqnaqyllqnsvkqysgkff

SCOPe Domain Coordinates for d1zzia_:

Click to download the PDB-style file with coordinates for d1zzia_.
(The format of our PDB-style files is described here.)

Timeline for d1zzia_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1zzib_