Lineage for d1zzea1 (1zze A:2-343)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 685975Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 685976Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 686289Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (70 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 686412Protein Aldehyde reductase II [117413] (1 species)
  7. 686413Species Sporobolomyces salmonicolor [TaxId:5005] [117414] (3 PDB entries)
  8. 686416Domain d1zzea1: 1zze A:2-343 [125900]
    automatically matched to 1Y1P A:2-343
    complexed with so4

Details for d1zzea1

PDB Entry: 1zze (more details), 1.8 Å

PDB Description: X-ray Structure of NADPH-dependent Carbonyl Reductase from Sporobolomyces salmonicolor
PDB Compounds: (A:) Aldehyde reductase II

SCOP Domain Sequences for d1zzea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zzea1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]}
akidnavlpegslvlvtgangfvashvveqllehgykvrgtarsasklanlqkrwdakyp
grfetavvedmlkqgaydevikgaagvahiasvvsfsnkydevvtpaiggtlnalraaaa
tpsvkrfvltsstvsalipkpnvegiyldekswnlesidkaktlpesdpqkslwvyaask
teaelaawkfmdenkphftlnavlpnytigtifdpetqsgstsgwmmslfngevspalal
mppqyyvsavdigllhlgclvlpqierrrvygtagtfdwntvlatfrklypsktfpadfp
dqgqdlskfdtapsleilkslgrpgwrsieesikdlvgseta

SCOP Domain Coordinates for d1zzea1:

Click to download the PDB-style file with coordinates for d1zzea1.
(The format of our PDB-style files is described here.)

Timeline for d1zzea1: