Lineage for d1zzea_ (1zze A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. 2841610Protein Aldehyde reductase II [117413] (1 species)
  7. 2841611Species Sporobolomyces salmonicolor [TaxId:5005] [117414] (3 PDB entries)
    Uniprot Q9UUN9
  8. 2841614Domain d1zzea_: 1zze A: [125900]
    automated match to d1ujma_
    complexed with so4

    has additional subdomain(s) that are not in the common domain

Details for d1zzea_

PDB Entry: 1zze (more details), 1.8 Å

PDB Description: X-ray Structure of NADPH-dependent Carbonyl Reductase from Sporobolomyces salmonicolor
PDB Compounds: (A:) Aldehyde reductase II

SCOPe Domain Sequences for d1zzea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zzea_ c.2.1.2 (A:) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]}
akidnavlpegslvlvtgangfvashvveqllehgykvrgtarsasklanlqkrwdakyp
grfetavvedmlkqgaydevikgaagvahiasvvsfsnkydevvtpaiggtlnalraaaa
tpsvkrfvltsstvsalipkpnvegiyldekswnlesidkaktlpesdpqkslwvyaask
teaelaawkfmdenkphftlnavlpnytigtifdpetqsgstsgwmmslfngevspalal
mppqyyvsavdigllhlgclvlpqierrrvygtagtfdwntvlatfrklypsktfpadfp
dqgqdlskfdtapsleilkslgrpgwrsieesikdlvgseta

SCOPe Domain Coordinates for d1zzea_:

Click to download the PDB-style file with coordinates for d1zzea_.
(The format of our PDB-style files is described here.)

Timeline for d1zzea_: