![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
![]() | Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (13 families) ![]() |
![]() | Family a.35.1.3: SinR domain-like [47432] (8 proteins) |
![]() | Protein Hydroxypropylphosphonic acid epoxidase Fom4, N-terminal domain [140516] (1 species) |
![]() | Species Streptomyces wedmorensis [TaxId:43759] [140517] (9 PDB entries) Uniprot Q56185 6-76 |
![]() | Domain d1zzcb1: 1zzc B:6-76 [125898] Other proteins in same PDB: d1zzca2, d1zzcb2 automatically matched to 1ZZ6 A:6-76 complexed with co, trs |
PDB Entry: 1zzc (more details), 1.8 Å
SCOP Domain Sequences for d1zzcb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zzcb1 a.35.1.3 (B:6-76) Hydroxypropylphosphonic acid epoxidase Fom4, N-terminal domain {Streptomyces wedmorensis [TaxId: 43759]} tastgfaellkdrreqvkmdhaalasllgetpetvaawengeggeltltqlgriahvlgt sigaltppagn
Timeline for d1zzcb1: