Lineage for d1zzca2 (1zzc A:77-198)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2814470Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2814471Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2814828Family b.82.1.10: TM1459-like [101976] (3 proteins)
  6. 2814829Protein Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain [141593] (1 species)
  7. 2814830Species Streptomyces wedmorensis [TaxId:43759] [141594] (14 PDB entries)
    Uniprot Q56185 77-198
  8. 2814833Domain d1zzca2: 1zzc A:77-198 [125897]
    Other proteins in same PDB: d1zzca1, d1zzcb1
    automated match to d1zz6a2
    complexed with co, trs

Details for d1zzca2

PDB Entry: 1zzc (more details), 1.8 Å

PDB Description: Crystal Structure of CoII HppE in Complex with Tris Buffer
PDB Compounds: (A:) Hydroxypropylphosphonic Acid Epoxidase

SCOPe Domain Sequences for d1zzca2:

Sequence, based on SEQRES records: (download)

>d1zzca2 b.82.1.10 (A:77-198) Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain {Streptomyces wedmorensis [TaxId: 43759]}
dlddgviiqmpderpilkgvrdnvdyyvynclvrtkrapslvplvvdvltdnpddakfns
ghagneflfvlegeihmkwgdkenpkeallptgasmfveehvphaftaakgtgsakliav
nf

Sequence, based on observed residues (ATOM records): (download)

>d1zzca2 b.82.1.10 (A:77-198) Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain {Streptomyces wedmorensis [TaxId: 43759]}
dlddgviiqmpyyvynclvrtkrapslvplvvdvltdnpddakfnsghagneflfvlege
ihmkwgdknpkeallptgasmfveehvphaftaakgtgsakliavnf

SCOPe Domain Coordinates for d1zzca2:

Click to download the PDB-style file with coordinates for d1zzca2.
(The format of our PDB-style files is described here.)

Timeline for d1zzca2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zzca1