Lineage for d1zzca1 (1zzc A:6-76)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 640241Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 640242Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (13 families) (S)
  5. 640325Family a.35.1.3: SinR domain-like [47432] (5 protein domains)
  6. 640326Protein Hydroxypropylphosphonic acid epoxidase Fom4, N-terminal domain [140516] (1 species)
  7. 640327Species Streptomyces wedmorensis [TaxId:43759] [140517] (9 PDB entries)
  8. 640332Domain d1zzca1: 1zzc A:6-76 [125896]
    Other proteins in same PDB: d1zzca2, d1zzcb2
    automatically matched to 1ZZ6 A:6-76
    complexed with co, trs

Details for d1zzca1

PDB Entry: 1zzc (more details), 1.8 Å

PDB Description: Crystal Structure of CoII HppE in Complex with Tris Buffer
PDB Compounds: (A:) Hydroxypropylphosphonic Acid Epoxidase

SCOP Domain Sequences for d1zzca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zzca1 a.35.1.3 (A:6-76) Hydroxypropylphosphonic acid epoxidase Fom4, N-terminal domain {Streptomyces wedmorensis [TaxId: 43759]}
tastgfaellkdrreqvkmdhaalasllgetpetvaawengeggeltltqlgriahvlgt
sigaltppagn

SCOP Domain Coordinates for d1zzca1:

Click to download the PDB-style file with coordinates for d1zzca1.
(The format of our PDB-style files is described here.)

Timeline for d1zzca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zzca2