SCOP 1.73: Domain d1zzca1: 1zzc A:6-76

Lineage for d1zzca1 (1zzc A:6-76)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (13 families)

5. Family a.35.1.3: SinR domain-like [47432] (5 proteins)

6. Protein Hydroxypropylphosphonic acid epoxidase Fom4, N-terminal domain [140516] (1 species)

7. Species Streptomyces wedmorensis [TaxId:43759] [140517] (9 PDB entries)

8. Domain d1zzca1: 1zzc A:6-76 [125896]
   Other proteins in same PDB: d1zzca2, d1zzcb2
   automatically matched to 1ZZ6 A:6-76
   complexed with co, trs

Details for d1zzca1

PDB Entry: 1zzc, 1.8 Å

PDB Description: Crystal Structure of CoII HppE in Complex with Tris Buffer

PDB Compounds: (A:) Hydroxypropylphosphonic Acid Epoxidase

SCOP Domain Sequences for d1zzca1:

Sequence; same for both SEQRES and ATOM records:

>d1zzca1 a.35.1.3 (A:6-76) Hydroxypropylphosphonic acid epoxidase Fom4, N-terminal domain {Streptomyces wedmorensis [TaxId: 43759]}
tastgfaellkdrreqvkmdhaalasllgetpetvaawengeggeltltqlgriahvlgt
sigaltppagn

Timeline for d1zzca1:

• d1zzca1 is new in SCOP 1.73
  
• d1zzca1 appears in SCOP 1.75
  
• d1zzca1 appears in the current release, SCOPe 2.08