Lineage for d1zzbb2 (1zzb B:77-198)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1807020Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 1807021Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 1807348Family b.82.1.10: TM1459-like [101976] (2 proteins)
  6. 1807349Protein Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain [141593] (1 species)
  7. 1807350Species Streptomyces wedmorensis [TaxId:43759] [141594] (14 PDB entries)
    Uniprot Q56185 77-198
  8. 1807369Domain d1zzbb2: 1zzb B:77-198 [125895]
    Other proteins in same PDB: d1zzba1, d1zzbb1
    automated match to d1zz6a2
    complexed with co, s0h

Details for d1zzbb2

PDB Entry: 1zzb (more details), 2.3 Å

PDB Description: Crystal Structure of CoII HppE in Complex with Substrate
PDB Compounds: (B:) Hydroxypropylphosphonic Acid Epoxidase

SCOPe Domain Sequences for d1zzbb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zzbb2 b.82.1.10 (B:77-198) Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain {Streptomyces wedmorensis [TaxId: 43759]}
dlddgviiqmpderpilkgvrdnvdyyvynclvrtkrapslvplvvdvltdnpddakfns
ghagneflfvlegeihmkwgdkenpkeallptgasmfveehvphaftaakgtgsakliav
nf

SCOPe Domain Coordinates for d1zzbb2:

Click to download the PDB-style file with coordinates for d1zzbb2.
(The format of our PDB-style files is described here.)

Timeline for d1zzbb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zzbb1