Lineage for d1zzbb1 (1zzb B:6-76)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2318756Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 2318757Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 2318854Family a.35.1.3: SinR domain-like [47432] (9 protein domains)
  6. 2318865Protein Hydroxypropylphosphonic acid epoxidase Fom4, N-terminal domain [140516] (1 species)
  7. 2318866Species Streptomyces wedmorensis [TaxId:43759] [140517] (14 PDB entries)
    Uniprot Q56185 6-76
  8. 2318883Domain d1zzbb1: 1zzb B:6-76 [125894]
    Other proteins in same PDB: d1zzba2, d1zzbb2
    automated match to d1zz6a1
    complexed with co, s0h

Details for d1zzbb1

PDB Entry: 1zzb (more details), 2.3 Å

PDB Description: Crystal Structure of CoII HppE in Complex with Substrate
PDB Compounds: (B:) Hydroxypropylphosphonic Acid Epoxidase

SCOPe Domain Sequences for d1zzbb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zzbb1 a.35.1.3 (B:6-76) Hydroxypropylphosphonic acid epoxidase Fom4, N-terminal domain {Streptomyces wedmorensis [TaxId: 43759]}
tastgfaellkdrreqvkmdhaalasllgetpetvaawengeggeltltqlgriahvlgt
sigaltppagn

SCOPe Domain Coordinates for d1zzbb1:

Click to download the PDB-style file with coordinates for d1zzbb1.
(The format of our PDB-style files is described here.)

Timeline for d1zzbb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zzbb2