Class a: All alpha proteins [46456] (258 folds) |
Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (13 families) |
Family a.35.1.3: SinR domain-like [47432] (5 proteins) |
Protein Hydroxypropylphosphonic acid epoxidase Fom4, N-terminal domain [140516] (1 species) |
Species Streptomyces wedmorensis [TaxId:43759] [140517] (9 PDB entries) |
Domain d1zzba1: 1zzb A:6-76 [125892] Other proteins in same PDB: d1zzba2, d1zzbb2 automatically matched to 1ZZ6 A:6-76 complexed with co, s0h |
PDB Entry: 1zzb (more details), 2.3 Å
SCOP Domain Sequences for d1zzba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zzba1 a.35.1.3 (A:6-76) Hydroxypropylphosphonic acid epoxidase Fom4, N-terminal domain {Streptomyces wedmorensis [TaxId: 43759]} tastgfaellkdrreqvkmdhaalasllgetpetvaawengeggeltltqlgriahvlgt sigaltppagn
Timeline for d1zzba1: