Class b: All beta proteins [48724] (174 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (25 families) |
Family b.82.1.10: TM1459-like [101976] (2 proteins) |
Protein Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain [141593] (1 species) |
Species Streptomyces wedmorensis [TaxId:43759] [141594] (9 PDB entries) Uniprot Q56185 77-198 |
Domain d1zz9c2: 1zz9 C:77-198 [125891] Other proteins in same PDB: d1zz9a1, d1zz9b1, d1zz9c1 automatically matched to 1ZZ6 A:77-198 complexed with fe2, so4 |
PDB Entry: 1zz9 (more details), 2.4 Å
SCOPe Domain Sequences for d1zz9c2:
Sequence, based on SEQRES records: (download)
>d1zz9c2 b.82.1.10 (C:77-198) Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain {Streptomyces wedmorensis [TaxId: 43759]} dlddgviiqmpderpilkgvrdnvdyyvynclvrtkrapslvplvvdvltdnpddakfns ghagneflfvlegeihmkwgdkenpkeallptgasmfveehvphaftaakgtgsakliav nf
>d1zz9c2 b.82.1.10 (C:77-198) Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain {Streptomyces wedmorensis [TaxId: 43759]} dlddgviiqmpderpilkgvvdyyvynclvrtkrapslvplvvdvltdnpddakfnsgha gneflfvlegeihmkwgdkenpkeallptgasmfveehvphaftaakgtgsakliavnf
Timeline for d1zz9c2:
View in 3D Domains from other chains: (mouse over for more information) d1zz9a1, d1zz9a2, d1zz9b1, d1zz9b2 |