Lineage for d1zz9c1 (1zz9 C:6-76)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1995687Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 1995688Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 1995785Family a.35.1.3: SinR domain-like [47432] (9 proteins)
  6. 1995796Protein Hydroxypropylphosphonic acid epoxidase Fom4, N-terminal domain [140516] (1 species)
  7. 1995797Species Streptomyces wedmorensis [TaxId:43759] [140517] (14 PDB entries)
    Uniprot Q56185 6-76
  8. 1995819Domain d1zz9c1: 1zz9 C:6-76 [125890]
    Other proteins in same PDB: d1zz9a2, d1zz9b2, d1zz9c2
    automated match to d1zz6a1
    complexed with fe2, so4

Details for d1zz9c1

PDB Entry: 1zz9 (more details), 2.4 Å

PDB Description: Crystal Structure of FeII HppE
PDB Compounds: (C:) Hydroxypropylphosphonic Acid Epoxidase

SCOPe Domain Sequences for d1zz9c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zz9c1 a.35.1.3 (C:6-76) Hydroxypropylphosphonic acid epoxidase Fom4, N-terminal domain {Streptomyces wedmorensis [TaxId: 43759]}
tastgfaellkdrreqvkmdhaalasllgetpetvaawengeggeltltqlgriahvlgt
sigaltppagn

SCOPe Domain Coordinates for d1zz9c1:

Click to download the PDB-style file with coordinates for d1zz9c1.
(The format of our PDB-style files is described here.)

Timeline for d1zz9c1: