Lineage for d1zz9b2 (1zz9 B:77-198)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2080271Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2080272Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2080608Family b.82.1.10: TM1459-like [101976] (3 proteins)
  6. 2080609Protein Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain [141593] (1 species)
  7. 2080610Species Streptomyces wedmorensis [TaxId:43759] [141594] (14 PDB entries)
    Uniprot Q56185 77-198
  8. 2080631Domain d1zz9b2: 1zz9 B:77-198 [125889]
    Other proteins in same PDB: d1zz9a1, d1zz9b1, d1zz9c1
    automated match to d1zz6a2
    complexed with fe2, so4

Details for d1zz9b2

PDB Entry: 1zz9 (more details), 2.4 Å

PDB Description: Crystal Structure of FeII HppE
PDB Compounds: (B:) Hydroxypropylphosphonic Acid Epoxidase

SCOPe Domain Sequences for d1zz9b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zz9b2 b.82.1.10 (B:77-198) Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain {Streptomyces wedmorensis [TaxId: 43759]}
dlddgviiqmpderpilkgvrdnvdyyvynclvrtkrapslvplvvdvltdnpddakfns
ghagneflfvlegeihmkwgdkenpkeallptgasmfveehvphaftaakgtgsakliav
nf

SCOPe Domain Coordinates for d1zz9b2:

Click to download the PDB-style file with coordinates for d1zz9b2.
(The format of our PDB-style files is described here.)

Timeline for d1zz9b2: