SCOP 1.75: Domain d1zz8b2: 1zz8 B:77-198

Lineage for d1zz8b2 (1zz8 B:77-198)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (24 families)

5. Family b.82.1.10: TM1459-like [101976] (2 proteins)

6. Protein Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain [141593] (1 species)

7. Species Streptomyces wedmorensis [TaxId:43759] [141594] (9 PDB entries)
   Uniprot Q56185 77-198

8. Domain d1zz8b2: 1zz8 B:77-198 [125883]
   Other proteins in same PDB: d1zz8a1, d1zz8b1, d1zz8c1
   automatically matched to 1ZZ6 A:77-198
   complexed with fe2, s0h

Details for d1zz8b2

PDB Entry: 1zz8, 2.3 Å

PDB Description: Crystal Structure of FeII HppE in Complex with Substrate Form 2

PDB Compounds: (B:) Hydroxypropylphosphonic Acid Epoxidase

SCOP Domain Sequences for d1zz8b2:

Sequence; same for both SEQRES and ATOM records:

>d1zz8b2 b.82.1.10 (B:77-198) Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain {Streptomyces wedmorensis [TaxId: 43759]}
dlddgviiqmpderpilkgvrdnvdyyvynclvrtkrapslvplvvdvltdnpddakfns
ghagneflfvlegeihmkwgdkenpkeallptgasmfveehvphaftaakgtgsakliav
nf

Timeline for d1zz8b2:

• d1zz8b2 first appeared in SCOP 1.73
  
• d1zz8b2 appears in SCOPe 2.01
  
• d1zz8b2 appears in the current release, SCOPe 2.08