Class a: All alpha proteins [46456] (286 folds) |
Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) |
Family a.35.1.3: SinR domain-like [47432] (9 proteins) |
Protein Hydroxypropylphosphonic acid epoxidase Fom4, N-terminal domain [140516] (1 species) |
Species Streptomyces wedmorensis [TaxId:43759] [140517] (14 PDB entries) Uniprot Q56185 6-76 |
Domain d1zz8a1: 1zz8 A:7-76 [125880] Other proteins in same PDB: d1zz8a2, d1zz8b2, d1zz8c2 automated match to d1zz6a1 complexed with fe2, s0h |
PDB Entry: 1zz8 (more details), 2.3 Å
SCOPe Domain Sequences for d1zz8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zz8a1 a.35.1.3 (A:7-76) Hydroxypropylphosphonic acid epoxidase Fom4, N-terminal domain {Streptomyces wedmorensis [TaxId: 43759]} astgfaellkdrreqvkmdhaalasllgetpetvaawengeggeltltqlgriahvlgts igaltppagn
Timeline for d1zz8a1:
View in 3D Domains from other chains: (mouse over for more information) d1zz8b1, d1zz8b2, d1zz8c1, d1zz8c2 |