Lineage for d1zz8a1 (1zz8 A:7-76)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1732724Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 1732725Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 1732822Family a.35.1.3: SinR domain-like [47432] (9 proteins)
  6. 1732833Protein Hydroxypropylphosphonic acid epoxidase Fom4, N-terminal domain [140516] (1 species)
  7. 1732834Species Streptomyces wedmorensis [TaxId:43759] [140517] (14 PDB entries)
    Uniprot Q56185 6-76
  8. 1732849Domain d1zz8a1: 1zz8 A:7-76 [125880]
    Other proteins in same PDB: d1zz8a2, d1zz8b2, d1zz8c2
    automated match to d1zz6a1
    complexed with fe2, s0h

Details for d1zz8a1

PDB Entry: 1zz8 (more details), 2.3 Å

PDB Description: Crystal Structure of FeII HppE in Complex with Substrate Form 2
PDB Compounds: (A:) Hydroxypropylphosphonic Acid Epoxidase

SCOPe Domain Sequences for d1zz8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zz8a1 a.35.1.3 (A:7-76) Hydroxypropylphosphonic acid epoxidase Fom4, N-terminal domain {Streptomyces wedmorensis [TaxId: 43759]}
astgfaellkdrreqvkmdhaalasllgetpetvaawengeggeltltqlgriahvlgts
igaltppagn

SCOPe Domain Coordinates for d1zz8a1:

Click to download the PDB-style file with coordinates for d1zz8a1.
(The format of our PDB-style files is described here.)

Timeline for d1zz8a1: