SCOP 1.73: Domain d1zz7b2: 1zz7 B:77-198

Lineage for d1zz7b2 (1zz7 B:77-198)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (20 families)

5. Family b.82.1.10: TM1459-like [101976] (2 proteins)

6. Protein Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain [141593] (1 species)

7. Species Streptomyces wedmorensis [TaxId:43759] [141594] (9 PDB entries)

8. Domain d1zz7b2: 1zz7 B:77-198 [125879]
   Other proteins in same PDB: d1zz7a1, d1zz7b1
   automatically matched to 1ZZ6 A:77-198
   complexed with fe2, s0h

Details for d1zz7b2

PDB Entry: 1zz7, 2.1 Å

PDB Description: Crystal Structure of FeII HppE in Complex with Substrate form 1

PDB Compounds: (B:) Hydroxyprophylphosphonic Acid Epoxidase

SCOP Domain Sequences for d1zz7b2:

Sequence, based on SEQRES records:

>d1zz7b2 b.82.1.10 (B:77-198) Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain {Streptomyces wedmorensis [TaxId: 43759]}
dlddgviiqmpderpilkgvrdnvdyyvynclvrtkrapslvplvvdvltdnpddakfns
ghagneflfvlegeihmkwgdkenpkeallptgasmfveehvphaftaakgtgsakliav
nf

Sequence, based on observed residues (ATOM records):

>d1zz7b2 b.82.1.10 (B:77-198) Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain {Streptomyces wedmorensis [TaxId: 43759]}
dlddgviiqmpyvynclvrtkrapslvplvvdvltdnpddakfnsghagneflfvlegei
hmkwgnpkeallptgasmfveehvphaftaakgtgsakliavnf

Timeline for d1zz7b2:

• d1zz7b2 is new in SCOP 1.73
  
• d1zz7b2 appears in SCOP 1.75
  
• d1zz7b2 appears in the current release, SCOPe 2.08