SCOPe 2.01: Domain d1zz7b1: 1zz7 B:7-76

Lineage for d1zz7b1 (1zz7 B:7-76)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.3: SinR domain-like [47432] (9 proteins)

6. Protein Hydroxypropylphosphonic acid epoxidase Fom4, N-terminal domain [140516] (1 species)

7. Species Streptomyces wedmorensis [TaxId:43759] [140517] (9 PDB entries)
   Uniprot Q56185 6-76

8. Domain d1zz7b1: 1zz7 B:7-76 [125878]
   Other proteins in same PDB: d1zz7a2, d1zz7b2
   automatically matched to 1ZZ6 A:6-76
   complexed with fe2, s0h

Details for d1zz7b1

PDB Entry: 1zz7, 2.1 Å

PDB Description: Crystal Structure of FeII HppE in Complex with Substrate form 1

PDB Compounds: (B:) Hydroxyprophylphosphonic Acid Epoxidase

SCOPe Domain Sequences for d1zz7b1:

Sequence; same for both SEQRES and ATOM records:

>d1zz7b1 a.35.1.3 (B:7-76) Hydroxypropylphosphonic acid epoxidase Fom4, N-terminal domain {Streptomyces wedmorensis [TaxId: 43759]}
astgfaellkdrreqvkmdhaalasllgetpetvaawengeggeltltqlgriahvlgts
igaltppagn

Timeline for d1zz7b1:

• d1zz7b1 first appeared in SCOP 1.73
  
• d1zz7b1 appears in SCOP 1.75
  
• d1zz7b1 appears in SCOPe 2.02
  
• d1zz7b1 appears in the current release, SCOPe 2.08