Class a: All alpha proteins [46456] (284 folds) |
Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) |
Family a.35.1.3: SinR domain-like [47432] (9 proteins) |
Protein Hydroxypropylphosphonic acid epoxidase Fom4, N-terminal domain [140516] (1 species) |
Species Streptomyces wedmorensis [TaxId:43759] [140517] (9 PDB entries) Uniprot Q56185 6-76 |
Domain d1zz7b1: 1zz7 B:7-76 [125878] Other proteins in same PDB: d1zz7a2, d1zz7b2 automatically matched to 1ZZ6 A:6-76 complexed with fe2, s0h |
PDB Entry: 1zz7 (more details), 2.1 Å
SCOPe Domain Sequences for d1zz7b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zz7b1 a.35.1.3 (B:7-76) Hydroxypropylphosphonic acid epoxidase Fom4, N-terminal domain {Streptomyces wedmorensis [TaxId: 43759]} astgfaellkdrreqvkmdhaalasllgetpetvaawengeggeltltqlgriahvlgts igaltppagn
Timeline for d1zz7b1: