Lineage for d1zz6a2 (1zz6 A:77-198)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 677266Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 677267Superfamily b.82.1: RmlC-like cupins [51182] (20 families) (S)
  5. 677532Family b.82.1.10: TM1459-like [101976] (2 proteins)
  6. 677533Protein Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain [141593] (1 species)
  7. 677534Species Streptomyces wedmorensis [TaxId:43759] [141594] (9 PDB entries)
  8. 677543Domain d1zz6a2: 1zz6 A:77-198 [125873]
    Other proteins in same PDB: d1zz6a1, d1zz6b1

Details for d1zz6a2

PDB Entry: 1zz6 (more details), 2 Å

PDB Description: Crystal Structure of Apo-HppE
PDB Compounds: (A:) Hydroxypropylphosphonic Acid Epoxidase

SCOP Domain Sequences for d1zz6a2:

Sequence, based on SEQRES records: (download)

>d1zz6a2 b.82.1.10 (A:77-198) Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain {Streptomyces wedmorensis [TaxId: 43759]}
dlddgviiqmpderpilkgvrdnvdyyvynclvrtkrapslvplvvdvltdnpddakfns
ghagneflfvlegeihmkwgdkenpkeallptgasmfveehvphaftaakgtgsakliav
nf

Sequence, based on observed residues (ATOM records): (download)

>d1zz6a2 b.82.1.10 (A:77-198) Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain {Streptomyces wedmorensis [TaxId: 43759]}
dlddgviiqmpderpilkgvyyvynclvrtkrapslvplvvdvltdnpddakfnsgnefl
fvlegeihmkwgdkeallptgasmfveehvphaftaakgtgsakliavnf

SCOP Domain Coordinates for d1zz6a2:

Click to download the PDB-style file with coordinates for d1zz6a2.
(The format of our PDB-style files is described here.)

Timeline for d1zz6a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zz6a1