SCOPe 2.06: Domain d1zyxa_: 1zyx A:

Lineage for d1zyxa_ (1zyx A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
   automatically mapped to Pfam PF00068

6. Protein automated matches [190139] (26 species)
   not a true protein

7. Species Daboia russellii [TaxId:97228] [186865] (27 PDB entries)

8. Domain d1zyxa_: 1zyx A: [125870]
   automated match to d1tgma_
   complexed with lcf, so4

Details for d1zyxa_

PDB Entry: 1zyx, 1.95 Å

PDB Description: crystal structure of the complex of a group iia phospholipase a2 with a synthetic anti-inflammatory agent licofelone at 1.9a resolution

PDB Compounds: (A:) Phospholipase A2 VRV-PL-VIIIa

SCOPe Domain Sequences for d1zyxa_:

Sequence; same for both SEQRES and ATOM records:

>d1zyxa_ a.133.1.2 (A:) automated matches {Daboia russellii [TaxId: 97228]}
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c

Timeline for d1zyxa_:

• d1zyxa_ first appeared in SCOP 1.73, called d1zyxa1
  
• d1zyxa_ appears in SCOPe 2.05
  
• d1zyxa_ appears in SCOPe 2.07
  
• d1zyxa_ appears in the current release, SCOPe 2.08