Class a: All alpha proteins [46456] (258 folds) |
Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) |
Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins) |
Protein Snake phospholipase A2 [48624] (35 species) |
Species Snake (Daboia russellii pulchella), different isoforms [TaxId:97228] [48630] (47 PDB entries) |
Domain d1zyxa1: 1zyx A:1-133 [125870] automatically matched to d1cl5a_ complexed with lcf, so4 |
PDB Entry: 1zyx (more details), 1.95 Å
SCOP Domain Sequences for d1zyxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zyxa1 a.133.1.2 (A:1-133) Snake phospholipase A2 {Snake (Daboia russellii pulchella), different isoforms [TaxId: 97228]} sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk c
Timeline for d1zyxa1: