SCOP 1.73: Domain d1zyxa1: 1zyx A:1-133

Lineage for d1zyxa1 (1zyx A:1-133)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)

6. Protein Snake phospholipase A2 [48624] (35 species)

7. Species Snake (Daboia russellii pulchella), different isoforms [TaxId:97228] [48630] (47 PDB entries)

8. Domain d1zyxa1: 1zyx A:1-133 [125870]
   automatically matched to d1cl5a_
   complexed with lcf, so4

Details for d1zyxa1

PDB Entry: 1zyx, 1.95 Å

PDB Description: crystal structure of the complex of a group iia phospholipase a2 with a synthetic anti-inflammatory agent licofelone at 1.9a resolution

PDB Compounds: (A:) Phospholipase A2 VRV-PL-VIIIa

SCOP Domain Sequences for d1zyxa1:

Sequence; same for both SEQRES and ATOM records:

>d1zyxa1 a.133.1.2 (A:1-133) Snake phospholipase A2 {Snake (Daboia russellii pulchella), different isoforms [TaxId: 97228]}
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c

Timeline for d1zyxa1:

• d1zyxa1 is new in SCOP 1.73
  
• d1zyxa1 appears in SCOP 1.75
  
• d1zyxa1 appears in the current release, SCOPe 2.08, called d1zyxa_