Lineage for d1zyro_ (1zyr O:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1751602Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily)
    core: 2 helices and adjacent loops
  4. 1751603Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) (S)
    the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits
  5. 1751604Family a.143.1.1: RNA polymerase omega subunit [63563] (2 proteins)
    4 helices; irregular array
  6. 1751605Protein RNA polymerase omega subunit [63564] (3 species)
  7. 1751623Species Thermus thermophilus [TaxId:274] [74729] (10 PDB entries)
    Uniprot Q8RQE7; part of multichain biological unit
  8. 1751641Domain d1zyro_: 1zyr O: [125865]
    Other proteins in same PDB: d1zyra1, d1zyra2, d1zyrb1, d1zyrb2, d1zyrc_, d1zyrd_, d1zyrf1, d1zyrf2, d1zyrf3, d1zyrk1, d1zyrk2, d1zyrl1, d1zyrl2, d1zyrm_, d1zyrn_, d1zyrp1, d1zyrp2, d1zyrp3
    automated match to d1i6ve_
    protein/RNA complex; complexed with mg, std, zn

Details for d1zyro_

PDB Entry: 1zyr (more details), 3 Å

PDB Description: Structure of Thermus thermophilus RNA polymerase holoenzyme in complex with the antibiotic streptolydigin
PDB Compounds: (O:) DNA-directed RNA polymerase omega chain

SCOPe Domain Sequences for d1zyro_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zyro_ a.143.1.1 (O:) RNA polymerase omega subunit {Thermus thermophilus [TaxId: 274]}
aepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpnae
twamkelltgrlvfgenlvpedrlqkemeriypge

SCOPe Domain Coordinates for d1zyro_:

Click to download the PDB-style file with coordinates for d1zyro_.
(The format of our PDB-style files is described here.)

Timeline for d1zyro_: