Lineage for d1zyrm_ (1zyr M:)

  1. Root: SCOPe 2.04
  2. 1689992Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1694801Fold e.29: beta and beta-prime subunits of DNA dependent RNA-polymerase [64483] (1 superfamily)
    Multidomain subunits of complex domain organization
  4. 1694802Superfamily e.29.1: beta and beta-prime subunits of DNA dependent RNA-polymerase [64484] (2 families) (S)
    The catalytic site is formed by the association of two double-psi beta-barrel domains, one from each subunit
  5. 1694803Family e.29.1.1: RNA-polymerase beta [64485] (3 proteins)
  6. 1694856Protein automated matches [190192] (4 species)
    not a true protein
  7. 1694874Species Thermus thermophilus [TaxId:274] [186932] (7 PDB entries)
  8. 1694888Domain d1zyrm_: 1zyr M: [125863]
    Other proteins in same PDB: d1zyra1, d1zyra2, d1zyrb1, d1zyrb2, d1zyrd_, d1zyre_, d1zyrf1, d1zyrf2, d1zyrf3, d1zyrk1, d1zyrk2, d1zyrl1, d1zyrl2, d1zyrn_, d1zyro_, d1zyrp1, d1zyrp2, d1zyrp3
    automated match to d1smyc_
    protein/RNA complex; complexed with mg, std, zn

Details for d1zyrm_

PDB Entry: 1zyr (more details), 3 Å

PDB Description: Structure of Thermus thermophilus RNA polymerase holoenzyme in complex with the antibiotic streptolydigin
PDB Compounds: (M:) DNA-directed RNA polymerase beta chain

SCOPe Domain Sequences for d1zyrm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zyrm_ e.29.1.1 (M:) automated matches {Thermus thermophilus [TaxId: 274]}
meikrfgrireviplpplteiqvesyrralqadvppekrenvgiqaafretfpieeedkg
kgglvldfleyrlgeppfpqdecrekdltyqaplyarlqlihkdtglikedevflghipl
mtedgsfiingadrvivsqihrspgvyftpdparpgryiasiiplpkrgpwidlevepng
vvsmkvnkrkfplvlllrvlgydqetlarelgaygelvqglmdesvfamrpeealirlft
llrpgdppkrdkavayvygliadprrydlgeagrykaeeklgirlsgrtlarfedgefkd
evflptlrylfaltagvpghevddidhlgnrrirtvgelmtdqfrvglarlargvrerml
mgsedsltpaklvnsrpleaaireffsrsqlsqfkdetnplsslrhkrrisalgpggltr
eragfdvrdvhrthygricpvetpeganiglitslaayarvdelgfirtpyrrvvggvvt
devvymtateedrytiaqantplegnriaaervvarrkgepvivspeevefmdvspkqvf
svntnlipflehddanralmgsnmqtqavpliraqapvvmtgleervvrdslaalyaeed
gevakvdgnrivvryedgrlveyplrrfyrsnqgtaldqrprvvvgqrvrkgdlladgpa
sengflalgqnvlvaimpfdgynfedaiviseellkrdfytsihieryeieardtklgpe
ritrdiphlseaalrdldeegvvrigaevkpgdilvgrtsfkgeseptpeerllrsifge
kardvkdtslrvppgeggivvrtvrlrrgdpgvelkpgvrevvrvyvaqkrklqvgdkla
nrhgnkgvvakilpvedmphlpdgtpvdvilnplgvpsrmnlgqilethlglagyflgqr
yispifdgakepeikellaqafevyfgkrkgegfgvdkrevevlrraeklglvtpgktpe
eqlkelflqgkvvlydgrtgepiegpivvgqmfimklyhmvedkmharstgpyslitqqp
lggkaqfggqrfgemevwaleaygaahtlqemltlksddiegrnaayeaiikgedvpeps
vpesfrvlvkelqalaldvqtldekdnpvdifeglaskr

SCOPe Domain Coordinates for d1zyrm_:

Click to download the PDB-style file with coordinates for d1zyrm_.
(The format of our PDB-style files is described here.)

Timeline for d1zyrm_: