| Class a: All alpha proteins [46456] (286 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (4 families) ![]() |
| Family a.4.13.0: automated matches [254211] (1 protein) not a true family |
| Protein automated matches [254475] (3 species) not a true protein |
| Domain d1zyrf2: 1zyr F:319-423 [125857] Other proteins in same PDB: d1zyra1, d1zyra2, d1zyrb1, d1zyrb2, d1zyrc_, d1zyrd_, d1zyre_, d1zyrf3, d1zyrk1, d1zyrk2, d1zyrl1, d1zyrl2, d1zyrm_, d1zyrn_, d1zyro_, d1zyrp3 automated match to d1smyf2 protein/RNA complex; complexed with mg, std, zn |
PDB Entry: 1zyr (more details), 3 Å
SCOPe Domain Sequences for d1zyrf2:
Sequence, based on SEQRES records: (download)
>d1zyrf2 a.4.13.0 (F:319-423) automated matches {Thermus thermophilus [TaxId: 274]}
tpigdekdsfygdfipdehlpspvdaatqsllseelekalsklsereamvlklrkglidg
rehtleevgaffgvtrerirqienkalrklkyhesrtrklrdfld
>d1zyrf2 a.4.13.0 (F:319-423) automated matches {Thermus thermophilus [TaxId: 274]}
tpigdekdsfygdfipdehlpspvdaatqsllseelekalsklsereamvlklrkglidg
eevgaffgvtrerirqienkalrklkyhesrtrklrdfld
Timeline for d1zyrf2: