SCOP 1.73: Domain d1zyqb1: 1zyq B:3-107

Lineage for d1zyqb1 (1zyq B:3-107)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (22 families)

5. Family c.47.1.1: Thioltransferase [52834] (15 proteins)

6. Protein Thioredoxin [52835] (12 species)

7. Species Escherichia coli [TaxId:562] [52836] (29 PDB entries)

8. Domain d1zyqb1: 1zyq B:3-107 [125848]
   Other proteins in same PDB: d1zyqa1, d1zyqa2
   automatically matched to d1xoa__
   complexed with 8og, dad, ddg, mg; mutant

Details for d1zyqb1

PDB Entry: 1zyq, 2.7 Å

PDB Description: t7 dna polymerase in complex with 8og and incoming ddatp

PDB Compounds: (B:) Thioredoxin 1

SCOP Domain Sequences for d1zyqb1:

Sequence; same for both SEQRES and ATOM records:

>d1zyqb1 c.47.1.1 (B:3-107) Thioredoxin {Escherichia coli [TaxId: 562]}
kiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklnidq
npgtapkygirgiptlllfkngevaatkvgalskgqlkefldanl

Timeline for d1zyqb1:

• d1zyqb1 is new in SCOP 1.73
  
• d1zyqb1 appears in SCOP 1.75
  
• d1zyqb1 appears in the current release, SCOPe 2.08, called d1zyqb_