Lineage for d1zyqa1 (1zyq A:1-210)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2493668Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) (S)
    consists of one domain of this fold
  5. 2494311Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins)
    contains Pfam PF00929
  6. 2494598Protein Exonuclease domain of T7 DNA polymerase [53123] (1 species)
  7. 2494599Species Bacteriophage T7 [TaxId:10760] [53124] (17 PDB entries)
    Uniprot P00581
  8. 2494614Domain d1zyqa1: 1zyq A:1-210 [125846]
    Other proteins in same PDB: d1zyqa2, d1zyqb_
    automated match to d1x9ma1
    protein/DNA complex; complexed with dad, mg

Details for d1zyqa1

PDB Entry: 1zyq (more details), 2.7 Å

PDB Description: t7 dna polymerase in complex with 8og and incoming ddatp
PDB Compounds: (A:) DNA polymerase

SCOPe Domain Sequences for d1zyqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zyqa1 c.55.3.5 (A:1-210) Exonuclease domain of T7 DNA polymerase {Bacteriophage T7 [TaxId: 10760]}
mivsdieanallesvtkfhcgviydystaeyvsyrpsdfgayldaleaevargglivfhn
ghkydvpaltklaklqlnrefhlprencidtlvlsrlihsnlkdtdmgllrsgklpgale
awgyrlgemkgeykddfkrmleeqgeeyvdgmewwnfneemmdynvqdvvvtkallekll
sdkhyfppeidftdvgyttfwses

SCOPe Domain Coordinates for d1zyqa1:

Click to download the PDB-style file with coordinates for d1zyqa1.
(The format of our PDB-style files is described here.)

Timeline for d1zyqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zyqa2
View in 3D
Domains from other chains:
(mouse over for more information)
d1zyqb_