SCOP 1.73: Domain d1zypb2: 1zyp B:103-196

Lineage for d1zypb2 (1zyp B:103-196)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (22 families)

5. Family c.47.1.2: PDI-like [52849] (2 proteins)
   duplication: contains two tandem repeats of this fold

6. Protein Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain [52853] (1 species)

7. Species Salmonella typhimurium [TaxId:90371] [52854] (3 PDB entries)

8. Domain d1zypb2: 1zyp B:103-196 [125845]
   automatically matched to d1hyua4

Details for d1zypb2

PDB Entry: 1zyp, 2.4 Å

PDB Description: Synchrotron reduced form of the N-terminal domain of Salmonella typhimurium AhpF

PDB Compounds: (B:) Alkyl hydroperoxide reductase subunit F

SCOP Domain Sequences for d1zypb2:

Sequence; same for both SEQRES and ATOM records:

>d1zypb2 c.47.1.2 (B:103-196) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 602]}
keaqslleqirdidgdfefetyyslschncpdvvqalnlmavlnprikhtaidggtfqne
iternvmgvpavfvngkefgqgrmtlteivakvd

Timeline for d1zypb2:

• d1zypb2 is new in SCOP 1.73
  
• d1zypb2 appears in SCOP 1.75
  
• d1zypb2 appears in the current release, SCOPe 2.08