SCOPe 2.05: Domain d1zypa2: 1zyp A:103-196

Lineage for d1zypa2 (1zyp A:103-196)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.2: PDI-like [52849] (3 proteins)
   duplication: contains two tandem repeats of this fold

6. Protein Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain [52853] (1 species)

7. Species Salmonella typhimurium [TaxId:90371] [52854] (3 PDB entries)

8. Domain d1zypa2: 1zyp A:103-196 [125843]
   automated match to d1hyua4

Details for d1zypa2

PDB Entry: 1zyp, 2.4 Å

PDB Description: Synchrotron reduced form of the N-terminal domain of Salmonella typhimurium AhpF

PDB Compounds: (A:) Alkyl hydroperoxide reductase subunit F

SCOPe Domain Sequences for d1zypa2:

Sequence; same for both SEQRES and ATOM records:

>d1zypa2 c.47.1.2 (A:103-196) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]}
keaqslleqirdidgdfefetyyslschncpdvvqalnlmavlnprikhtaidggtfqne
iternvmgvpavfvngkefgqgrmtlteivakvd

Timeline for d1zypa2:

• d1zypa2 first appeared in SCOP 1.73
  
• d1zypa2 appears in SCOPe 2.04
  
• d1zypa2 appears in SCOPe 2.06
  
• d1zypa2 appears in the current release, SCOPe 2.08