Lineage for d1zypa2 (1zyp A:103-196)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 698982Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 698983Superfamily c.47.1: Thioredoxin-like [52833] (22 families) (S)
  5. 699191Family c.47.1.2: PDI-like [52849] (2 proteins)
    duplication: contains two tandem repeats of this fold
  6. 699192Protein Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain [52853] (1 species)
  7. 699193Species Salmonella typhimurium [TaxId:90371] [52854] (3 PDB entries)
  8. 699201Domain d1zypa2: 1zyp A:103-196 [125843]
    automatically matched to d1hyua4

Details for d1zypa2

PDB Entry: 1zyp (more details), 2.4 Å

PDB Description: Synchrotron reduced form of the N-terminal domain of Salmonella typhimurium AhpF
PDB Compounds: (A:) Alkyl hydroperoxide reductase subunit F

SCOP Domain Sequences for d1zypa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zypa2 c.47.1.2 (A:103-196) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 602]}
keaqslleqirdidgdfefetyyslschncpdvvqalnlmavlnprikhtaidggtfqne
iternvmgvpavfvngkefgqgrmtlteivakvd

SCOP Domain Coordinates for d1zypa2:

Click to download the PDB-style file with coordinates for d1zypa2.
(The format of our PDB-style files is described here.)

Timeline for d1zypa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zypa1