Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (22 families) |
Family c.47.1.2: PDI-like [52849] (2 proteins) duplication: contains two tandem repeats of this fold |
Protein Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain [52853] (1 species) |
Species Salmonella typhimurium [TaxId:90371] [52854] (3 PDB entries) |
Domain d1zypa2: 1zyp A:103-196 [125843] automatically matched to d1hyua4 |
PDB Entry: 1zyp (more details), 2.4 Å
SCOP Domain Sequences for d1zypa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zypa2 c.47.1.2 (A:103-196) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 602]} keaqslleqirdidgdfefetyyslschncpdvvqalnlmavlnprikhtaidggtfqne iternvmgvpavfvngkefgqgrmtlteivakvd
Timeline for d1zypa2: