![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
![]() | Family c.47.1.2: PDI-like [52849] (3 proteins) duplication: contains two tandem repeats of this fold |
![]() | Protein Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain [52853] (1 species) |
![]() | Species Salmonella typhimurium [TaxId:90371] [52854] (3 PDB entries) |
![]() | Domain d1zypa1: 1zyp A:1-102 [125842] automated match to d1hyua3 |
PDB Entry: 1zyp (more details), 2.4 Å
SCOPe Domain Sequences for d1zypa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zypa1 c.47.1.2 (A:1-102) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} mldtnmktqlraylekltkpveliatlddsaksaeikellaeiaelsdkvtfkedntlpv rkpsflitnpgsqqgprfagsplgheftslvlallwtgghps
Timeline for d1zypa1: