| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.2: PDI-like [52849] (3 proteins) duplication: contains two tandem repeats of this fold |
| Protein Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain [52853] (1 species) |
| Species Salmonella typhimurium [TaxId:90371] [52854] (3 PDB entries) |
| Domain d1zynb1: 1zyn B:1-102 [125840] automated match to d1hyua3 |
PDB Entry: 1zyn (more details), 2.3 Å
SCOPe Domain Sequences for d1zynb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zynb1 c.47.1.2 (B:1-102) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]}
mldtnmktqlraylekltkpveliatlddsaksaeikellaeiaelsdkvtfkedntlpv
rkpsflitnpgsqqgprfagsplgheftslvlallwtgghps
Timeline for d1zynb1: