Lineage for d1zykd1 (1zyk D:1-70)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 770284Fold a.46: Methionine synthase domain-like [47643] (3 superfamilies)
    4 helices; bundle, left-handed twist; right-handed superhelix
  4. 770294Superfamily a.46.2: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47648] (1 family) (S)
  5. 770295Family a.46.2.1: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47649] (3 proteins)
  6. 770296Protein Anthranilate phosphoribosyltransferase (TrpD) [81774] (3 species)
  7. 770297Species Archaeon Sulfolobus solfataricus [TaxId:2287] [81775] (5 PDB entries)
  8. 770305Domain d1zykd1: 1zyk D:1-70 [125836]
    Other proteins in same PDB: d1zyka2, d1zykb2, d1zykc2, d1zykd2
    automatically matched to d1gxba1
    complexed with be2, mg, prp

Details for d1zykd1

PDB Entry: 1zyk (more details), 2.4 Å

PDB Description: anthranilate phosphoribosyltransferase in complex with prpp, anthranilate and magnesium
PDB Compounds: (D:) Anthranilate phosphoribosyltransferase

SCOP Domain Sequences for d1zykd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zykd1 a.46.2.1 (D:1-70) Anthranilate phosphoribosyltransferase (TrpD) {Archaeon Sulfolobus solfataricus [TaxId: 2287]}
mnineilkklinksdleineaeelakaiirgevpeilvsailvalrmkgeskneivgfar
amrelaikid

SCOP Domain Coordinates for d1zykd1:

Click to download the PDB-style file with coordinates for d1zykd1.
(The format of our PDB-style files is described here.)

Timeline for d1zykd1: